PWP2H (PWP2) Rabbit Polyclonal Antibody

CAT#: TA338924

Rabbit Polyclonal Anti-PWP2 Antibody

Product Images

WB Suggested Anti-PWP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: PWP2; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml.PWP2 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: PWP2; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml.PWP2 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: PWP2; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml.PWP2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PWP2 antibody: synthetic peptide directed towards the middle region of human PWP2. Synthetic peptide located within the following region: VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 102 kDa
• Gene Name: PWP2 periodic tryptophan protein homolog (yeast)
• Database Link:
  NP_005040
  Entrez Gene 5822 Human
  UniProt ID Q15269
• Background: PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.
• Synonyms: EHOC-17; PWP2H; UTP1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%