MLKL Rabbit Polyclonal Antibody

SKU TA338895

Rabbit Polyclonal Anti-MLKL Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLKL antibody: synthetic peptide directed towards the N terminal of human MLKL. Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: mixed lineage kinase domain-like
• Database Link:
  NP_689862
  Q8NB16
• Background: The specific function of this protein remains unknown.
• Synonyms: hMLKL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 91%; Rat: 90%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase