MLKL Rabbit Polyclonal Antibody

SKU
TA338895
Rabbit Polyclonal Anti-MLKL Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MLKL antibody: synthetic peptide directed towards the N terminal of human MLKL. Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 54 kDa
Gene Name mixed lineage kinase domain-like
Database Link
Background The specific function of this protein remains unknown.
Synonyms hMLKL
Note Immunogen Sequence Homology: Human: 100%; Horse: 91%; Rat: 90%; Bovine: 85%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:MLKL Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.