C1orf55 (SDE2) Rabbit Polyclonal Antibody

SKU TA338885

Rabbit Polyclonal Anti-SDE2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf55 antibody: synthetic peptide directed towards the C terminal of human C1orf55. Synthetic peptide located within the following region: AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: SDE2 telomere maintenance homolog
• Database Link:
  NP_689821
  Q6IQ49
• Background: SDE2 is phosphorylated upon DNA damage, probably by ATM or ATR. The exact function of SDE2 remains unknown.
• Synonyms: C1orf55; dJ671D7.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 92%; Rabbit: 92%

Reference Data