Scfd2 Rabbit Polyclonal Antibody

CAT#: TA338870

Rabbit Polyclonal Anti-Scfd2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Scfd2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Scfd2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name Sec1 family domain containing 2
Background The function of this protein remains unknown.
Synonyms FLJ21060; FLJ39514; STXBP1L1
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Bovine: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.