RAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody

SKU TA338849

Rabbit Polyclonal Anti-RAD9B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAD9B antibody: synthetic peptide directed towards the middle region of human RAD9B. Synthetic peptide located within the following region: SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: RAD9 checkpoint clamp component B
• Database Link:
  NP_689655
  Q6WBX8
• Background: The specific function of this protein remains unknown.
• Synonyms: FLJ40346; MGC75426
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 79%; Horse: 79%

Reference Data