VPS37A Rabbit Polyclonal Antibody

CAT#: TA338843

Rabbit Polyclonal Anti-VPS37A Antibody

Product Images

WB Suggested Anti-VPS37A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VPS37A antibody: synthetic peptide directed towards the N terminal of human VPS37A. Synthetic peptide located within the following region: SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: VPS37A, ESCRT-I subunit
• Database Link:
  NP_689628
  Entrez Gene 137492 Human
  UniProt ID Q8NEZ2
• Background: VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.
• Synonyms: HCRP1; PQBP2; SPG53
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%; Yeast: 82%

Reference Data

• Protein Pathways: Endocytosis