TREML2 Rabbit Polyclonal Antibody

SKU TA338679

Rabbit Polyclonal Anti-TREML2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TREML2 antibody: synthetic peptide directed towards the N terminal of human TREML2. Synthetic peptide located within the following region: GRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDNILKSGTVTTG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: triggering receptor expressed on myeloid cells like 2
• Database Link:
  NP_079083
  Q5T2D2
• Background: TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response.
• Synonyms: C6orf76; dJ238O23.1; TLT-2; TLT2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 92%; Rabbit: 86%; Pig: 85%; Dog: 77%; Rat: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane