TMEM180 (MFSD13A) Rabbit Polyclonal Antibody

SKU TA338677

Rabbit Polyclonal Anti-TMEM180 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM180 antibody: synthetic peptide directed towards the middle region of human TMEM180. Synthetic peptide located within the following region: CLFIASNRVFTEGTCKLLTLVVTDLVDEDLVLNHRKQAASALLFGMVALVT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: major facilitator superfamily domain containing 13A
• Database Link:
  NP_079065
  Q14CX5
• Background: The function of TMEM180 remains unknown.
• Synonyms: bA18I14.8; C10orf77; TMEM180
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane