ARV1 Rabbit Polyclonal Antibody

SKU TA338620

Rabbit Polyclonal Anti-ARV1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARV1 antibody: synthetic peptide directed towards the middle region of human ARV1. Synthetic peptide located within the following region: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: ARV1 homolog, fatty acid homeostasis modulator
• Database Link:
  NP_073623
  Q9H2C2
• Background: ARV1 may act as a mediator of sterol homeostasis.
• Synonyms: ARV1 homolog; ARV1 homolog (S. cerevisiae); OTTHUMP00000035970
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 85%; Goat: 85%; Bovine: 85%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane