DNAJC1 Rabbit Polyclonal Antibody

SKU TA338600

Rabbit Polyclonal Anti-DNAJC1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNAJC1 antibody: synthetic peptide directed towards the C terminal of human DNAJC1. Synthetic peptide located within the following region: ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member C1
• Database Link:
  NP_071760
  Q96KC8
• Background: DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.
• Synonyms: DNAJL1; ERdj1; HTJ1; MTJ1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors, Transmembrane