DNAJC1 Rabbit Polyclonal Antibody

SKU
TA338600
Rabbit Polyclonal Anti-DNAJC1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DNAJC1 antibody: synthetic peptide directed towards the C terminal of human DNAJC1. Synthetic peptide located within the following region: ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 64 kDa
Gene Name DnaJ heat shock protein family (Hsp40) member C1
Database Link
Background DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.
Synonyms DNAJL1; ERdj1; HTJ1; MTJ1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 86%
Reference Data
Protein Families Transcription Factors, Transmembrane
Write Your Own Review
You're reviewing:DNAJC1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.