Nav1.6 (SCN8A) Rabbit Polyclonal Antibody

SKU TA338572

Rabbit Polyclonal Anti-SCN8A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCN8A antibody: synthetic peptide directed towards the middle region of human SCN8A. Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 225 kDa
• Gene Name: sodium voltage-gated channel alpha subunit 8
• Database Link:
  NP_055006
  Q9UQD0
• Background: This gene encodes a member of the sodium channel alpha subunit gene family. The encoded protein forms the ion pore region of the voltage-gated sodium channel. This protein is essential for the rapid membrane depolarization that occurs during the formation of the action potential in excitable neurons. Mutations in this gene are associated with mental retardation, pancerebellar atrophy and ataxia. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• Synonyms: CERIII; CIAT; EIEE13; MED; NaCh6; Nav1.6; PN4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Sodium, Transmembrane