HTR3B Rabbit Polyclonal Antibody

CAT#: TA338559

Rabbit Polyclonal Anti-HTR3B Antibody

Product Images

WB Suggested Anti-HTR3B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

• 

  Rabbit Anti-HTR3B Antibody; Paraffin Embedded Tissue: Human Spleen; Cellular Data: Spleen cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Sample Type : Spinal Cord, ventral horns;

Specifications

Product Data

• Applications: IF, IHC, WB
• Recommended Dilution: WB, IHC, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: 5-hydroxytryptamine receptor 3B
• Database Link:
  NP_006019
  Entrez Gene 57014 MouseEntrez Gene 9177 Human
  UniProt ID O95264
• Background: The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functional as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functional features of this receptor. [provided by RefSeq, Aug 2011]
• Synonyms: 5-HT3B
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%; Bovine: 79%; Guinea pig: 79%; Dog: 77%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane