ASIC3 Rabbit Polyclonal Antibody

SKU TA338543

Rabbit Polyclonal Anti-ACCN3 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACCN3 antibody: synthetic peptide directed towards the N terminal of human ACCN3. Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: acid sensing ion channel subunit 3
• Database Link:
  NP_004760
  Q9UHC3
• Background: This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 2 has been observed as proton-gated channels sensitive to gadolinium. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]
• Synonyms: ACCN3; DRASIC; SLNAC1; TNaC1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 87%; Rat: 87%; Mouse: 87%; Rabbit: 87%; Dog: 80%; Horse: 80%; Bovine: 80%; Guinea pig: 80%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other