TCTA Rabbit Polyclonal Antibody

SKU TA338492

Rabbit Polyclonal Anti-TCTA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCTA antibody: synthetic peptide directed towards the middle region of human TCTA. Synthetic peptide located within the following region: IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 11 kDa
• Gene Name: T-cell leukemia translocation altered
• Database Link:
  NP_071503
  P57738
• Background: A chromosomal aberration, translocation t(1;3)(p34;p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).
• Synonyms: 9130410M22Rik; AW553637; C85065; Tctal
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%

Reference Data

• Protein Families: Transmembrane