CDH19 Rabbit Polyclonal Antibody

SKU TA338457

Rabbit Polyclonal Anti-CDH19 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDH19 antibody is: synthetic peptide directed towards the middle region of Human CDH19. Synthetic peptide located within the following region: LLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: cadherin 19
• Database Link:
  NP_001257957
  Q9H159
• Background: This gene is one of three related type II cadherin genes situated in a cluster on chromosome 18. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein containing five extracellular cadherin repeats. Loss of cadherins may be associated with cancer formation. Alternative splicing results in multiple transcript variants for this gene.
• Synonyms: CDH7; CDH7L2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane