FAM62B (ESYT2) Rabbit Polyclonal Antibody

SKU TA338432

Rabbit Polyclonal Anti-ESYT2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ESYT2antibody: synthetic peptide directed towards the middle region of human FAM62B. Synthetic peptide located within the following region: NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 99 kDa
• Gene Name: extended synaptotagmin protein 2
• Database Link:
  NP_065779
  A0FGR8
• Background: ESYT2may play a role as calcium-regulated intrinsic membrane protein.
• Synonyms: CHR2SYT; E-Syt2; FAM62B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 85%

Reference Data

• Protein Families: Transmembrane