Entpd7 Rabbit Polyclonal Antibody

SKU TA338412

Rabbit Polyclonal Anti-Entpd7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Entpd7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Entpd7. Synthetic peptide located within the following region: GMAWPVLAQRFKNGLFSSHADEHRLKYQCFKSAWMYEVLHEGFHFPYDYP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: ectonucleoside triphosphate diphosphohydrolase 7
• Database Link:
  NP_444333
  Q3TCT4
• Background: Entpd7 preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP .
• Synonyms: DKFZp667O124; FLJ30978; FLJ31830; FLJ41522; FLJ95364; LALP1; MGC141913; RP11-483F11.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data