DMGDH Rabbit Polyclonal Antibody

SKU
TA338400
Rabbit Polyclonal Anti-Dmgdh Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 93 kDa
Gene Name dimethylglycine dehydrogenase
Database Link
Background The function of this protein remains unknown.
Synonyms DMGDHD; ME2GLYDH
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Guinea pig: 92%; Zebrafish: 83%
Reference Data
Protein Pathways Glycine, Metabolic pathways, serine and threonine metabolism
Write Your Own Review
You're reviewing:DMGDH Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.