BRD9 Rabbit Polyclonal Antibody

SKU
TA338343
Rabbit Polyclonal Anti-BRD9 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Mouse, Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BRD9 antibody: synthetic peptide directed towards the N terminal of human BRD9. Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 53 kDa
Gene Name bromodomain containing 9
Database Link
Background BRD9 is a member of protein family that contains bromodomain. It is potentially related to cancer.
Synonyms LAVS3040; PRO9856
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Zebrafish: 77%
Reference Data
Write Your Own Review
You're reviewing:BRD9 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.