BRD9 Rabbit Polyclonal Antibody

CAT#: TA338343

Rabbit Polyclonal Anti-BRD9 Antibody

Product Images

Lanes: 1: 60ug mouse melanocytes (melba), 2: 60ug mouse melanoma (B16), 3: 60ug human melanocytes (HFSC), 4: 60ug human melanoma (SK-MEL5), 5: 60ug human melanoma (YUMAC), 6: 60ug rat shwann cell; Primary Antibody Dilution: ; 1:200; Secondary Antibody: ;

• 

  WB Suggested Anti-BRD9 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate BRD9 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRD9 antibody: synthetic peptide directed towards the N terminal of human BRD9. Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: bromodomain containing 9
• Database Link:
  NP_001009877
  Entrez Gene 105246 MouseEntrez Gene 308067 RatEntrez Gene 65980 Human
  UniProt ID Q9H8M2
• Background: BRD9 is a member of protein family that contains bromodomain. It is potentially related to cancer.
• Synonyms: LAVS3040; PRO9856
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Zebrafish: 77%