OST4 Rabbit Polyclonal Antibody

SKU TA338306

Rabbit Polyclonal Anti-OST4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OST4 antibody is: synthetic peptide directed towards the C-terminal region of Human OST4. Synthetic peptide located within the following region: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 4 kDa
• Gene Name: oligosaccharyltransferase complex subunit 4, non-catalytic
• Database Link:
  NP_001128165
  P0C6T2
• Background: OST4 may be involved in N-glycosylation through its association with N-oligosaccharyl transferase.
• Synonyms: DKFZp586A0722
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 93%; Dog: 83%

Reference Data