GRID2IP Rabbit Polyclonal Antibody

SKU TA338301

Rabbit Polyclonal Anti-GRID2IP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRID2IP antibody is: synthetic peptide directed towards the middle region of Human GRID2IP. Synthetic peptide located within the following region: CFLGYTAMTAEPEPELDLESEPTPEPQPRSSLRASSMCRRSLRSQGLEAG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 132 kDa
• Gene Name: Grid2 interacting protein
• Database Link:
  NP_001138590
  A4D2P6
• Background: Glutamate receptor delta-2 is predominantly expressed at parallel fiber-Purkinje cell postsynapses and plays crucial roles in synaptogenesis and synaptic plasticity. GRID2IP1 interacts with GRID2 and may control GRID2 signaling in Purkinje cells.
• Synonyms: DELPHILIN
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 91%; Rat: 87%; Mouse: 87%; Rabbit: 86%; Bovine: 79%; Dog: 75%

Reference Data