Troponin C (TNNC2) Rabbit Polyclonal Antibody

SKU TA338237

Rabbit Polyclonal Anti-TNNC2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNNC2 antibody is: synthetic peptide directed towards the N-terminal region of Human TNNC2. Synthetic peptide located within the following region: ISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 15 kDa
• Gene Name: troponin C2, fast skeletal type
• Database Link:
  NP_003270
  P02585
• Background: The function of this protein remains unknown.
• Synonyms: fast; fast skeletal muscle troponin C; OTTHUMP00000039531; troponin C2; troponin C type 2 (fast)
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Pathways: Calcium signaling pathway