Carbohydrate sulfotransferase 1 (CHST1) Rabbit Polyclonal Antibody

SKU TA338222

Rabbit Polyclonal Anti-CHST1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHST1 antibody: synthetic peptide directed towards the middle region of human CHST1. Synthetic peptide located within the following region: YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: carbohydrate sulfotransferase 1
• Database Link:
  NP_003645
  O43916
• Background: This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011]
• Synonyms: C6ST; GST-1; KS6ST; KSGal6ST; KSST
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Keratan sulfate biosynthesis, Metabolic pathways