Carbohydrate sulfotransferase 1 (CHST1) Rabbit Polyclonal Antibody

CAT#: TA338221

Rabbit Polyclonal Anti-CHST1 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 (CHST1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Carbohydrate sulfotransferase 1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHST1 antibody: synthetic peptide directed towards the N terminal of human CHST1. Synthetic peptide located within the following region: SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name carbohydrate sulfotransferase 1
Background This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011]
Synonyms C6ST; GST-1; KS6ST; KSGal6ST; KSST
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data
Protein Families Transmembrane
Protein Pathways Keratan sulfate biosynthesis, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.