PTCH2 Rabbit Polyclonal Antibody

SKU TA338213

Rabbit Polyclonal Anti-PTCH2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTCH2 antibody: synthetic peptide directed towards the N terminal of human PTCH2. Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 130 kDa
• Gene Name: patched 2
• Database Link:
  NP_003729
  Q9Y6C5
• Background: This gene encodes a transmembrane receptor of the patched gene family. The encoded protein may function as a tumor suppressor in the hedgehog signaling pathway. Alterations in this gene have been associated with nevoid basal cell carcinoma syndrome, basal cell carcinoma, medulloblastoma, and susceptibility to congenital macrostomia. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]
• Synonyms: PTC2
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 86%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Basal cell carcinoma, Hedgehog signaling pathway, Pathways in cancer