B3GALT2 Rabbit Polyclonal Antibody

CAT#: TA338206

Rabbit Polyclonal Anti-B3galt2 Antibody

Product Images

WB Suggested Anti-B3galt2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Mouse Brain

• 

  Sample Type: Adult mouse cortex Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-Cy3; Secondary Antibody: Dilution: 1: 1000; Color/Signal Descriptions: Red: B3Galt2 Cyan: Nissl (Neurons); Gene Name: B3galt2; Submitted by: Joshua R. Sanes,

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B3galt2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: beta-1,3-galactosyltransferase 2
• Database Link:
  NP_003774
  Entrez Gene 26878 Mouse
  UniProt ID O43825
• Background: B3galt2 is beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. B3galt2 can also utilize substrates with a terminal galactose residue, albeit with lower efficiency. B3galt2 is involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins.
• Synonyms: beta3Gal-T2; BETA3GALT2; GLCT2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways