REPS2 Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 665.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-REPS2 antibody is: synthetic peptide directed towards the C-terminal region of Human REPS2. Synthetic peptide located within the following region: KDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 57 kDa |
Gene Name | RALBP1 associated Eps domain containing 2 |
Database Link | |
Background | The product of this gene is part of a protein complex that regulates the endocytosis of growth factor receptors. The encoded protein directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene. |
Synonyms | POB1 |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Rat: 86%; Mouse: 83%; Dog: 80%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review