GPR22 Rabbit Polyclonal Antibody

SKU TA338157

Rabbit Polyclonal Anti-GPR22 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR22 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR22. Synthetic peptide located within the following region: KVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSEIREKC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: G protein-coupled receptor 22
• Database Link:
  NP_005286
  Q99680
• Background: This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein.
• Synonyms: MGC129847
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane