IFI30 Rabbit Polyclonal Antibody

SKU TA338132

Rabbit Polyclonal Anti-IFI30 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFI30 antibody is: synthetic peptide directed towards the middle region of Human IFI30. Synthetic peptide located within the following region: YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: IFI30, lysosomal thiol reductase
• Database Link:
  NP_006323
  P13284
• Background: The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing.
• Synonyms: GILT; IFI-30; IP-30; IP30
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%

Reference Data

• Protein Pathways: Antigen processing and presentation