C1orf2 (FAM189B) Rabbit Polyclonal Antibody

SKU TA338129

Rabbit Polyclonal Anti-FAM189B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf2 antibody: synthetic peptide directed towards the N terminal of human C1orf2. Synthetic peptide located within the following region: PLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGLTICAAIICTLSA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: family with sequence similarity 189 member B
• Database Link:
  NP_006580
  P81408
• Background: The exact function of C1orf2 remains unknown.
• Synonyms: C1orf2; COTE1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Rat: 87%; Mouse: 87%; Bovine: 87%; Guinea pig: 80%

Reference Data

• Protein Families: Transmembrane