ZNF22 Rabbit Polyclonal Antibody

SKU TA338119

Rabbit Polyclonal Anti-ZNF22 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF22 antibody: synthetic peptide directed towards the C terminal of human ZNF22. Synthetic peptide located within the following region: TGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: zinc finger protein 22
• Database Link:
  NP_008894
  P17026
• Background: ZNF22 encodes a protein that is expressed in the epithelial component of the developing tooth organ during early bud and cap stages as well as in osteoblasts of craniofacial bone and the developing tongue.
• Synonyms: HKR-T1; KOX15; Zfp422; ZNF422
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Bovine: 91%

Reference Data

• Protein Families: Transcription Factors