NUDT5 Rabbit Polyclonal Antibody

SKU TA338097

Rabbit Polyclonal Anti-NUDT5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUDT5 antibody is: synthetic peptide directed towards the N-terminal region of Human NUDT5. Synthetic peptide located within the following region: EKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: nudix hydrolase 5
• Database Link:
  NP_054861
  Q9UKK9
• Background: Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites.
• Synonyms: hNUDT5; YSA1; YSA1H; YSAH1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Pathways: Purine metabolism