Repulsive Guidance Molecule A (RGMA) Rabbit Polyclonal Antibody

SKU
TA338026
Rabbit Polyclonal Anti-Rgma Antibody
$575.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Rgma antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rgma. Synthetic peptide located within the following region: LPPAGDSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 38 kDa
Gene Name repulsive guidance molecule family member a
Database Link
Background The function of this protein remains unknown.
Synonyms RGM
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 92%; Dog: 86%
Reference Data
Write Your Own Review
You're reviewing:Repulsive Guidance Molecule A (RGMA) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.