L2HGDH Rabbit Polyclonal Antibody

SKU TA337982

Rabbit Polyclonal Anti-L2HGDH Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-L2HGDH antibody is: synthetic peptide directed towards the middle region of Human L2HGDH. Synthetic peptide located within the following region: GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: L-2-hydroxyglutarate dehydrogenase
• Database Link:
  NP_079160
  Q9H9P8
• Background: This gene encodes L-2-hydroxyglutarate dehydrogenase, a FAD-dependent enzyme that oxidizes L-2-hydroxyglutarate to alpha-ketoglutarate in a variety of mammalian tissues. Mutations in this gene cause L-2-hydroxyglutaric aciduria, a rare autosomal recessive neurometabolic disorder resulting in moderate to severe mental retardation.
• Synonyms: C14orf160; L2HGA
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 91%; Dog: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Pathways: Butanoate metabolism