CEP135 Rabbit Polyclonal Antibody

SKU TA337980

Rabbit Polyclonal Anti-CEP135 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CEP135 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP135. Synthetic peptide located within the following region: REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 133 kDa
• Gene Name: centrosomal protein 135
• Database Link:
  NP_079285
  Q66GS9
• Background: CEP135 is a centrosomal protein involved in centriole biogenesis. CEP135 acts as a scaffolding protein during early centriole biogenesis. CEP135 is also required for centriole-centriole cohesion during interphase by acting as a platform protein for CEP250 at the centriole.
• Synonyms: CEP4; KIAA0635; MCPH8
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 85%; Rabbit: 85%; Dog: 77%; Pig: 77%; Bovine: 77%

Reference Data