CEP135 Rabbit Polyclonal Antibody

CAT#: TA337980

Rabbit Polyclonal Anti-CEP135 Antibody


USD 539.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "CEP135"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CEP135 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP135. Synthetic peptide located within the following region: REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 133 kDa
Gene Name centrosomal protein 135
Background CEP135 is a centrosomal protein involved in centriole biogenesis. CEP135 acts as a scaffolding protein during early centriole biogenesis. CEP135 is also required for centriole-centriole cohesion during interphase by acting as a platform protein for CEP250 at the centriole.
Synonyms CEP4; KIAA0635; MCPH8
Note Immunogen Sequence Homology: Human: 100%; Horse: 85%; Rabbit: 85%; Dog: 77%; Pig: 77%; Bovine: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.