SLC25A2 Rabbit Polyclonal Antibody

CAT#: TA337957

Rabbit Polyclonal Anti-SLC25A2 Antibody

Product Images

WB Suggested Anti-SLC25A2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC25A2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC25A2. Synthetic peptide located within the following region: VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: solute carrier family 25 member 2
• Database Link:
  NP_114153
  Entrez Gene 83884 Human
  UniProt ID Q9BXI2
• Background: SLC25A2 is located between the protocadherin beta and gamma gene clusters on chromosome 5, this intronless gene encodes a protein that is highly similar to an ornithine transporter localized in the mitochondrial inner membrane. The encoded protein most likely plays a role in metabolism as a mitochondrial transport protein.
• Synonyms: ORC2; ORNT2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane