SLC25A2 Rabbit Polyclonal Antibody

CAT#: TA337957

Reviews ()
Write a review

Rabbit Polyclonal Anti-SLC25A2 Antibody

 Product Datasheet for 'TA337957'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC25A2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC25A2. Synthetic peptide located within the following region: VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 32 kDa
Gene Name solute carrier family 25 member 2
Background SLC25A2 is located between the protocadherin beta and gamma gene clusters on chromosome 5, this intronless gene encodes a protein that is highly similar to an ornithine transporter localized in the mitochondrial inner membrane. The encoded protein most likely plays a role in metabolism as a mitochondrial transport protein.
Synonyms ORC2; ORNT2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Transmembrane
Other products for "SLC25A2"
Frequently bought together (2)
Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2 (SLC25A2), nuclear gene encoding mitochondrial protein
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones