STK19 Rabbit Polyclonal Antibody

SKU TA337952

Rabbit Polyclonal Anti-STK19 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK19 antibody is: synthetic peptide directed towards the middle region of Human STK19. Synthetic peptide located within the following region: PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: serine/threonine kinase 19
• Database Link:
  NP_115830
  P49842
• Background: This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants.
• Synonyms: D6S60; D6S60E; G11; HLA-RP1; RP1
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 92%; Mouse: 86%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase