OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STK19 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337952
Rabbit Polyclonal Anti-STK19 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY410091 Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP318770 Purified recombinant protein of Homo sapiens serine/threonine kinase 19 (STK19), transcript variant 1, 20 µg
20 ug
$867.00

View other "STK19 or NM_032454" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-STK19 antibody is: synthetic peptide directed towards the middle region of Human STK19. Synthetic peptide located within the following region: PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 41 kDa
Gene Name serine/threonine kinase 19
Database Link
Background This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants.
Synonyms D6S60; D6S60E; G11; HLA-RP1; RP1
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 92%; Mouse: 86%; Rat: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products