TRIM14 Rabbit Polyclonal Antibody

CAT#: TA337948

Rabbit Polyclonal Anti-TRIM14 Antibody

Product Images

WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: tripartite motif containing 14
• Database Link:
  NP_150090
  Entrez Gene 9830 Human
  UniProt ID Q14142
• Background: TRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been describedThe protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.
• Synonyms: KIAA0129; OTTHUMP00000021761; OTTHUMP00000021762; OTTHUMP00000021763; OTTHUMP00000021764; tripartite motif-containing 14; tripartite motif protein 14; tripartite motif protein TRIM14
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome