ZNF627 Rabbit Polyclonal Antibody

CAT#: TA337900

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF627 Antibody



USD 485.00


Availability*
5 Days

Size
    • 100 ul


Product images

Other products for "ZNF627"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF627 antibody: synthetic peptide directed towards the N terminal of human ZNF627. Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name zinc finger protein 627
Background ZNF627 is a new candidate transcription factor
Synonyms FLJ90365
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.