Prepl Rabbit Polyclonal Antibody

SKU TA337893

Rabbit Polyclonal Anti-Prepl Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Prepl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prepl. Synthetic peptide located within the following region: LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: prolyl endopeptidase-like
• Database Link:
  NP_666096
  Q8C167
• Background: Prepl is a probable serine peptidase whose precise substrate specificity remains unclear. It does not cleave peptides after a arginine or lysine residue.
• Synonyms: FLJ16627; KIAA0436; OTTHUMP00000202420; OTTHUMP00000202421; OTTHUMP00000202424; OTTHUMP00000202425; OTTHUMP00000202426; Prolylendopeptidase-like
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 86%

Reference Data