Intersectin 2 (ITSN2) Rabbit Polyclonal Antibody

CAT#: TA337891

Rabbit Polyclonal Anti-ITSN2 Antibody

Product Images

WB Suggested Anti-ITSN2 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ITSN2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITSN2. Synthetic peptide located within the following region: TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 142 kDa
• Gene Name: intersectin 2
• Database Link:
  NP_671494
  Entrez Gene 50618 Human
  UniProt ID Q9NZM3
• Background: This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis. Alternatively spliced transcript variants have been found for this gene that encode three distinct isoforms. Additional variants have been found but their full length nature has not been determined.
• Synonyms: PRO2015; SH3D1B; SH3P18; SWA; SWAP
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Bovine: 86%; Mouse: 85%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome