c8orf84 (SBSPON) Rabbit Polyclonal Antibody

SKU TA337851

Rabbit Polyclonal Anti-SBSPON Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SBSPON antibody: synthetic peptide directed towards the middle region of human SBSPON. Synthetic peptide located within the following region: LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: somatomedin B and thrombospondin type 1 domain containing
• Database Link:
  NP_694957
  Q8IVN8
• Background: SBSPON belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of SBSPON remains unknown.
• Synonyms: C8orf84; RPESP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data