ENPP6 Rabbit Polyclonal Antibody

SKU TA337843

Rabbit Polyclonal Anti-ENPP6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ENPP6 antibody: synthetic peptide directed towards the middle region of human ENPP6. Synthetic peptide located within the following region: ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: ectonucleotide pyrophosphatase/phosphodiesterase 6
• Database Link:
  NP_699174
  Q6UWR7
• Background: ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase. ENPP6 hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5'-monophosphate. ENPP6 hydrolyzes lysophosphatidylcholine (LPC) to form monoacylglycerol and phosphorylcholine but not lysophosphatidic acid, showing it has a lysophospholipase C activity. ENPP6 has a preference for LPC with short (12:0 and 14:0) or polyunsaturated (18:2 and 20:4) fatty acids. Also hydrolyzes glycerophosphorylcholine and sphingosylphosphorylcholine efficiently.
• Synonyms: NPP6
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%; Bovine: 92%; Zebrafish: 85%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Ether lipid metabolism