SCUBE1 Rabbit Polyclonal Antibody

CAT#: TA337797

Rabbit Polyclonal Anti-SCUBE1 Antibody

Product Images

Host: Rabbit; Target Name: SCUBE1; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCUBE1 antibody is: synthetic peptide directed towards the N-terminal region of Human SCUBE1. Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: signal peptide, CUB domain and EGF like domain containing 1
• Database Link:
  NP_766638
  Entrez Gene 80274 Human
  UniProt ID Q8IWY4
• Background: This gene encodes a cell surface glycoprotein that is a member of the SCUBE (signal peptide, CUB domain, EGF (epidermal growth factor)-like protein) family. Family members have an amino-terminal signal peptide, nine copies of EGF-like repeats and a CUB domain at the carboxyl terminus. This protein is expressed in platelets and endothelial cells and may play an important role in vascular biology.
• Synonyms: SCUBE1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein