UBE2Q2 Rabbit Polyclonal Antibody

SKU TA337794

Rabbit Polyclonal Anti-UBE2Q2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBE2Q2 antibody is: synthetic peptide directed towards the middle region of Human UBE2Q2. Synthetic peptide located within the following region: EDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: ubiquitin conjugating enzyme E2 Q2
• Database Link:
  NP_775740
  Q8WVN8
• Background: UBE2Q2 accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro UBE2Q2 catalyzes 'Lys-48'-linked polyubiquitination.
• Synonyms: DKFZp762C143
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 92%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis