C18orf54 Rabbit Polyclonal Antibody

SKU TA337775

Rabbit Polyclonal Anti-C18orf54 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C18orf54 antibody: synthetic peptide directed towards the middle region of human C18orf54. Synthetic peptide located within the following region: PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: chromosome 18 open reading frame 54
• Database Link:
  NP_775800
  Q8IYD9
• Background: The exact function of C18orf54 remains unknown.
• Synonyms: LAS2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Guinea pig: 85%

Reference Data

• Protein Families: Secreted Protein