ZCCHC12 Rabbit Polyclonal Antibody

SKU TA337769

Rabbit Polyclonal Anti-ZCCHC12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZCCHC12 antibody: synthetic peptide directed towards the N terminal of human ZCCHC12. Synthetic peptide located within the following region: AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: zinc finger CCHC-type containing 12
• Database Link:
  NP_776159
  Q6PEW1
• Background: ZCCHC12 contains 1 CCHC-type zinc finger. ZCCHC12 is the transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway. It positively modulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex. It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression.
• Synonyms: PNMA7A; SIZN; SIZN1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data