DGKH Rabbit Polyclonal Antibody

CAT#: TA337746

Rabbit Polyclonal Anti-DGKH Antibody

Product Images

WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human heart

• 

  Sample Type: Adult mouse cortex Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-Cy3; Secondary Antibody: Dilution: 1: 1000; Color/Signal Descriptions: Red: DGKH Cyan: Nissl (Neurons); Gene Name: DGKH; Submitted by: Joshua R. Sanes, Mole

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 135 kDa
• Gene Name: diacylglycerol kinase eta
• Database Link:
  NP_821077
  Entrez Gene 380921 MouseEntrez Gene 160851 Human
  UniProt ID Q86XP1
• Background: This gene encodes a member of the diacylglycerol kinase (DGK) enzyme family. Members of this family are involved in regulating intracellular concentrations of diacylglycerol and phosphatidic acid. Variation in this gene has been associated with bipolar disorder. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Jul 2014]
• Synonyms: DGKeta
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system