Gastrokine 2 (GKN2) Rabbit Polyclonal Antibody

SKU TA337724

Rabbit Polyclonal Anti-GKN2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GKN2 antibody is: synthetic peptide directed towards the N-terminal region of Human GKN2. Synthetic peptide located within the following region: NIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSSTTIFDYKHGYIASR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 18 kDa
• Gene Name: gastrokine 2
• Database Link:
  NP_872342
  Q86XP6
• Background: The function of this protein remains unknown.
• Synonyms: BRICD1B; GDDR; PRO813; TFIZ1; VLTI465
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 91%; Dog: 85%; Mouse: 85%; Rabbit: 77%

Reference Data

• Protein Families: Secreted Protein