PADI6 Rabbit Polyclonal Antibody

CAT#: TA337699

Rabbit Polyclonal Anti-PADI6 Antibody

Product Images

Host: Rabbit; Target Name: PADI6; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PADI6 antibody is: synthetic peptide directed towards the N-terminal region of Human PADI6. Synthetic peptide located within the following region: GAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: peptidyl arginine deiminase 6
• Database Link:
  NP_997304
  Entrez Gene 353238 Human
  UniProt ID Q6TGC4
• Background: This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. This protein may play a role in cytoskeletal reorganization in the egg and in early embryo development.
• Synonyms: hPADVI
• Note: Immunogen Sequence Homology: Human: 100%